The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
sequence length |
221
|
structure length |
214
|
Chain Sequence |
HHHHEFDHLKDLFRDRLIIDKVQRRLPYMFQLAELESSRAGKVGMEVGSLRERIISSLLIYKFGEKNVETDLPITEPEIDVKLFGSPISIKTITGKEPAGVKLIWTVDATKARQFLETWHPRFDLILVHINWSSLGGVYYIPDYVQQRIFDEIGKDKYIKLPKQGTNPRGVEISNEALKEIMTDEETMSIKIEWKKTNVQYNAFKRWVDLWSEG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
DNA intercalation without flipping in the specific ThaI-DNA complex
pubmed doi rcsb |
molecule tags |
Hydrolase/dna
|
source organism |
Thermoplasma acidophilum
|
molecule keywords |
restriction endonuclease THAI
|
total genus |
69
|
structure length |
214
|
sequence length |
221
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-06-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF15514 | ThaI | Restriction endonuclease ThaI |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | ECO RV Endonuclease; Chain A | ECO RV Endonuclease; Chain A |
#chains in the Genus database with same CATH superfamily 3NDH A; #chains in the Genus database with same CATH topology 4RVE A; 3E40 A; 2B0E A; 2RVE A; 1KC6 A; 2GIG A; 1EV7 A; 1B95 A; 1BGB A; 1DMU A; 1TW8 A; 1RVC A; 1RV5 A; 2GE5 A; 2GII A; 3E45 A; 1STX A; 2GIE A; 2AOQ A; 1EON A; 1SUZ A; 1B94 A; 1B96 A; 1AZ0 A; 2GIH A; 1EOP A; 1SX8 A; 2B0D A; 1AZ3 A; 4PXG A; 3E3Y A; 1BSS A; 5F8A A; 3NDH A; 1XHV A; 1RVB A; 5HLK A; 3E44 A; 2REU A; 1SX5 A; 1IAW A; 2GIJ A; 1XHU A; 1BUA A; 1EOO A; 3EBC A; 1TX3 A; 1RVE A; 2F03 A; 1AZ4 A; 1B97 A; 2AZO A; 3E42 A; 3E43 A; 2AOR A; 1BSU A; 1EO3 A; 1AZO A; 2AUD A; 3E41 A; 2EZV A; 1RVA A; 1EO4 A; #chains in the Genus database with same CATH homology 3NDH A; 2EZV A; 2F03 A; 1DMU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...