The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
179
|
structure length |
179
|
Chain Sequence |
PITLDEFLKLPETEPASEYIEGKIIQKPMPQGKHSAIQSECVSVINSVVKPQRIARAFLELRCTFGDHSTVPDISVFIWSRIPREENGEIANIFLIAPDWTIEILSPDQSQTKVTKNILHCLKHGTQMGWLIDPDEQTVFVYRPQQETEVFDEPDALVPVPSFASELHLSIKDLFSWLL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of a putative nuclease belonging to DUF820 (Ava_3926) from Anabaena variabilis ATCC 29413 at 1.96 A resolution
rcsb |
| molecule keywords |
Uncharacterized protein
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Anabaena variabilis
|
| total genus |
50
|
| structure length |
179
|
| sequence length |
179
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-09-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05685 | Uma2 | Putative restriction endonuclease |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | tt1808, chain A | tt1808, chain A |
#chains in the Genus database with same CATH superfamily 1WDJ A; 3OT2 A; #chains in the Genus database with same CATH topology 1WDJ A; 4I43 B; 4XJX A; 3IJM A; 4BEC A; 4BEB A; 3ZEF B; 3OT2 A; 2W00 A; 3S1S A; 3H1T A; 4BE7 B; #chains in the Genus database with same CATH homology 1WDJ A; 4I43 B; 4XJX A; 3IJM A; 4BEC A; 4BEB A; 3ZEF B; 3OT2 A; 2W00 A; 3S1S A; 3H1T A; 4BE7 B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...