The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
201
|
structure length |
199
|
Chain Sequence |
HDHHHDGYQAPPEDIALRVKALESLLIEKGLVDPAAMDLVVQTYEHKVGPRNGAKVVAKAWVDPAYKARLLADGTAGIAELGFSGVQGEDMVILENTPAVHNVFVCTLSYPWPTLGLPPAWYKAAPYRSRMVSDPRGVLAEFGLVIPANKEIRVWDTTAELRYMVLPERPAGTEAYSEEQLAELVTRDSMIGTGLPTQP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Evidence of the Participation of Remote Residues in the Catalytic Activity of Co-Type Nitrile Hydratase from Pseudomonas putida.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| source organism |
Pseudomonas putida
|
| molecule keywords |
Co-type Nitrile Hydratase alpha subunit
|
| total genus |
63
|
| structure length |
199
|
| sequence length |
201
|
| chains with identical sequence |
C, E, G
|
| ec nomenclature | |
| pdb deposition date | 2011-03-04 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Nitrile Hydratase; Chain A | Nitrile hydratase alpha /Thiocyanate hydrolase gamma |
#chains in the Genus database with same CATH superfamily 4ZGJ A; 2QDY A; 2ZPH A; 3QYH A; 3A8G A; 4OB3 A; 3HHT A; 3WVE A; 1UGQ A; 2DD4 C; 2DXC C; 2DXB C; 2DD5 C; 1UGP A; 3A8O A; 3WVD A; 2ZZD C; 4FM4 A; 4ZGD A; 2CYZ A; 2ZPI A; 3X20 A; 3VYH A; 1IRE A; 2CZ7 A; 2AHJ A; 3A8H A; 2ZPG A; 1UGS A; 4ZGE A; 1V29 A; 2CZ6 A; 3A8L A; 4OB2 A; 3A8M A; 3QZ5 A; 2CZ0 A; 3VYG C; 3QYG A; 2CZ1 A; 1UGR A; 2ZCF A; 3X24 A; 3QZ9 A; 2ZPE A; 3X25 A; 2ZPB A; 2D0Q A; 2DPP A; 3X28 A; 3X26 A; 4OB0 A; 4OB1 A; 3QXE A; 1AHJ A; 2ZPF A; #chains in the Genus database with same CATH topology 4ZGJ A; 2QDY A; 2ZPH A; 3QYH A; 3A8G A; 4OB3 A; 3HHT A; 3WVE A; 1UGQ A; 2DD4 C; 2DXC C; 2DXB C; 2DD5 C; 1UGP A; 3A8O A; 3WVD A; 2ZZD C; 4FM4 A; 4ZGD A; 2CYZ A; 2ZPI A; 3X20 A; 3VYH A; 1IRE A; 2CZ7 A; 2AHJ A; 3A8H A; 2ZPG A; 1UGS A; 4ZGE A; 1V29 A; 2CZ6 A; 3A8L A; 4OB2 A; 3A8M A; 3QZ5 A; 2CZ0 A; 3VYG C; 3QYG A; 2CZ1 A; 1UGR A; 2ZCF A; 3X24 A; 3QZ9 A; 2ZPE A; 3X25 A; 2ZPB A; 2D0Q A; 2DPP A; 3X28 A; 3X26 A; 4OB0 A; 4OB1 A; 3QXE A; 1AHJ A; 2ZPF A; #chains in the Genus database with same CATH homology 4ZGJ A; 2QDY A; 2ZPH A; 3QYH A; 3A8G A; 4OB3 A; 3HHT A; 3WVE A; 1UGQ A; 2DD4 C; 2DXC C; 2DXB C; 2DD5 C; 1UGP A; 3A8O A; 3WVD A; 2ZZD C; 4FM4 A; 4ZGD A; 2CYZ A; 2ZPI A; 3X20 A; 3VYH A; 1IRE A; 2CZ7 A; 2AHJ A; 3A8H A; 2ZPG A; 1UGS A; 4ZGE A; 1V29 A; 2CZ6 A; 3A8L A; 4OB2 A; 3A8M A; 3QZ5 A; 2CZ0 A; 3VYG C; 3QYG A; 2CZ1 A; 1UGR A; 2ZCF A; 3X24 A; 3QZ9 A; 2ZPE A; 3X25 A; 2ZPB A; 2D0Q A; 2DPP A; 3X28 A; 3X26 A; 4OB0 A; 4OB1 A; 3QXE A; 1AHJ A; 2ZPF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
