3V53A

Crystal structure of human rbm25
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
110
Chain Sequence
HHHHMKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and functional characterization of the human RBM25 PWI domain and its flanking basic region
pubmed doi rcsb
molecule keywords RNA-binding protein 25
molecule tags Rna binding protein
source organism Homo sapiens
total genus 29
structure length 110
sequence length 113
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01480 PWI PWI domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1390.10 Mainly Alpha Up-down Bundle PWI domain PWI domain 3v53A00
1MP1A 1X4QA 3V53A
chains in the Genus database with same CATH superfamily
1MP1A 2IX3A 2IW3A 3V53A 2IWHA 1X4QA
chains in the Genus database with same CATH topology
1MP1A 2IX3A 2IW3A 3V53A 2IWHA 1X4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MP1 A;  1X4Q A;  3V53 A; 
#chains in the Genus database with same CATH topology
 1MP1 A;  2IX3 A;  2IW3 A;  3V53 A;  2IWH A;  1X4Q A; 
#chains in the Genus database with same CATH homology
 1MP1 A;  2IX3 A;  2IW3 A;  3V53 A;  2IWH A;  1X4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...