The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
46
|
structure length |
46
|
Chain Sequence |
HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
molecule keywords |
Cytochrome c oxidase subunit 1
|
total genus |
13
|
structure length |
46
|
sequence length |
46
|
chains with identical sequence |
Y
|
ec nomenclature | |
pdb deposition date | 2009-12-16 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Cytochrome C Oxidase; Chain L | Cytochrome c oxidase subunit VIIc |
#chains in the Genus database with same CATH superfamily 3X2Q L; 3WG7 L; 2OCC L; 2EIM L; 2Y69 L; 2DYR L; 3ABL L; 1OCR L; 1V54 L; 3ABK L; 3AG3 L; 2EIJ L; 5IY5 L; 2EIK L; 3AG1 L; 5B1A L; 3ASN L; 2EIL L; 3ASO L; 3ABM L; 3AG2 L; 1OCZ L; 1OCC L; 1OCO L; 5B1B L; 3AG4 L; 2EIN L; 1V55 L; 2ZXW L; 5B3S L; 2DYS L; #chains in the Genus database with same CATH topology 3X2Q L; 3WG7 L; 2OCC L; 2EIM L; 2Y69 L; 2DYR L; 3ABL L; 1OCR L; 1V54 L; 3ABK L; 3AG3 L; 2EIJ L; 5IY5 L; 2EIK L; 3AG1 L; 5B1A L; 3ASN L; 2EIL L; 3ASO L; 3ABM L; 3AG2 L; 1OCZ L; 1OCC L; 1OCO L; 5B1B L; 3AG4 L; 2EIN L; 1V55 L; 2ZXW L; 5B3S L; 2DYS L; #chains in the Genus database with same CATH homology 3X2Q L; 3WG7 L; 2OCC L; 2EIM L; 2Y69 L; 2DYR L; 3ABL L; 1OCR L; 1V54 L; 3ABK L; 3AG3 L; 2EIJ L; 5IY5 L; 2EIK L; 3AG1 L; 5B1A L; 3ASN L; 2EIL L; 3ASO L; 3ABM L; 3AG2 L; 1OCZ L; 1OCC L; 1OCO L; 5B1B L; 3AG4 L; 2EIN L; 1V55 L; 2ZXW L; 5B3S L; 2DYS L;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...