The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
49
|
structure length |
46
|
Chain Sequence |
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb |
| molecule tags |
Ribosome
|
| molecule keywords |
50S ribosomal protein L2P
|
| total genus |
10
|
| structure length |
46
|
| sequence length |
49
|
| ec nomenclature | |
| pdb deposition date | 2008-03-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| 2 | PF00832 | Ribosomal_L39 | Ribosomal L39 protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Atp Synthase Epsilon Chain; Chain: I; | Ribosomal protein L39e |
#chains in the Genus database with same CATH superfamily 1YJN 2; 3CCU 2; 1VQK 2; 1VQN 2; 1Q7Y 3; 3CME 2; 1YIJ 2; 1KD1 3; 3CC2 2; 1N8R 3; 1VQ4 2; 3CCE 2; 1Q86 3; 3CC7 2; 1VQ6 2; 1KQS 1; 1S72 2; 2QEX 2; 3CMA 2; 1NJI 3; 1Q81 3; 1VQ5 2; 3G4S 2; 1Q82 3; 2QA4 2; 1YJ9 2; 1VQM 2; 1YI2 2; 3CD6 2; 1M90 3; 1K73 3; 3CCR 2; 1QVG 1; 3OW2 1; 3CC4 2; 1YJW 2; 3CXC 1; 3I56 2; 2OTJ 2; 1VQL 2; 1K9M 3; 1VQ7 2; 1VQ9 2; 1W2B 1; 1KC8 3; 3G71 2; 3I55 2; 1JJ2 1; 3CPW 1; 3CCQ 2; 3CCL 2; 1VQP 2; 1YIT 2; 1M1K 3; 2OTL 2; 3CCJ 2; 3G6E 2; 1YHQ 2; 3CCS 2; 1VQO 2; 1QVF 1; 1K8A 3; 3CCM 2; 3CCV 2; 1VQ8 2; #chains in the Genus database with same CATH topology 1YJN 2; 3CCU 2; 1VQK 2; 4YXW I; 1Q7Y 3; 1VQN 2; 3CME 2; 1YIJ 2; 1KD1 3; 3CC2 2; 2XOK I; 1N8R 3; 3CCE 2; 1Q86 3; 3CC7 2; 1VQ4 2; 1VQ6 2; 1KQS 1; 1S72 2; 2QEX 2; 3CMA 2; 1NJI 3; 1Q81 3; 1VQ5 2; 3G4S 2; 1Q82 3; 2QA4 2; 1YJ9 2; 1VQM 2; 1YI2 2; 3CD6 2; 1M90 3; 1K73 3; 3CCR 2; 1QVG 1; 3OW2 1; 3CC4 2; 1YJW 2; 2WSS I; 3I56 2; 3CXC 1; 2OTJ 2; 1VQL 2; 1K9M 3; 1VQ7 2; 1VQ9 2; 1W2B 1; 1KC8 3; 3G71 2; 3I55 2; 1JJ2 1; 3ZIA I; 3CPW 1; 3CCQ 2; 3CCL 2; 2XND I; 1E79 I; 2V7Q I; 1VQP 2; 1YIT 2; 3CCJ 2; 3G6E 2; 1M1K 3; 2OTL 2; 1YHQ 2; 3OFN I; 3CCS 2; 1VQO 2; 2WPD I; 1QVF 1; 1K8A 3; 3CCM 2; 3CCV 2; 1VQ8 2; #chains in the Genus database with same CATH homology 1YJN 2; 3CCU 2; 1VQK 2; 1VQN 2; 1Q7Y 3; 3CME 2; 1YIJ 2; 1KD1 3; 3CC2 2; 1N8R 3; 1VQ4 2; 3CCE 2; 1Q86 3; 3CC7 2; 1VQ6 2; 1KQS 1; 1S72 2; 2QEX 2; 3CMA 2; 1NJI 3; 1Q81 3; 1VQ5 2; 3G4S 2; 1Q82 3; 2QA4 2; 1YJ9 2; 1VQM 2; 1YI2 2; 3CD6 2; 1M90 3; 1K73 3; 3CCR 2; 1QVG 1; 3OW2 1; 3CC4 2; 1YJW 2; 3CXC 1; 3I56 2; 2OTJ 2; 1VQL 2; 1K9M 3; 1VQ7 2; 1VQ9 2; 1W2B 1; 1KC8 3; 3G71 2; 3I55 2; 1JJ2 1; 3CPW 1; 3CCQ 2; 3CCL 2; 1VQP 2; 1YIT 2; 1M1K 3; 2OTL 2; 3CCJ 2; 3G6E 2; 1YHQ 2; 3CCS 2; 1VQO 2; 1QVF 1; 1K8A 3; 3CCM 2; 3CCV 2; 1VQ8 2;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
