3HQGA

Crystal structure of restriction endonuclease ecorii catalytic c-terminal domain in complex with cognate dna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
222
structure length
222
Chain Sequence
YILPEDWHLRFPSGSEIIQYAASHYVKNSLDPDEQLLDRRRVEYDIFLLVEELHVLDIIRKGFGSVDEFIALANSVSNRRKSRAGKSLELHLEHLFIEHGLRHFATQAITEGNKKPDFLFPSAGAYHDTEFPVENLRMLAVKTTCKDRWRQILNEADKIHQVHLFTLQEGVSLAQYREMRESGVRLVVPSSLHKKYPEAVRAELMTLGAFIAELTGLYADIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Type-2 restriction enzyme EcoRII
publication title Structural mechanisms for the 5'-CCWGG sequence recognition by the N- and C-terminal domains of EcoRII.
pubmed doi rcsb
source organism Escherichia coli
total genus 76
structure length 222
sequence length 222
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2009-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09019 EcoRII-C EcoRII C terminal
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...