3J79H

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, large subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
185
structure length
185
Chain Sequence
KTIVSTQKVLIPEGVKVAINARKVTVSGKYGTLRRSFRHLPIDIRLNKLKKYIKVVMWFGVPDSLACIRTVCTHLKNMFTGVTKKFLYKMRLVHAHFPINSNIVDNNTRIEIRNYLGEKSVRFVKALPGVVIEKSPNVKDEIYVSGADIENVSLTAALIHQSVLCRNKDIRKFLDGIYVSEVTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule keywords 28S ribosomal RNA
total genus 33
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...