3MX1A

The structure of giy-yig endonuclease r.eco29ki
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
208
Chain Sequence
NKKFDRSEHVYRNDSFLELIKDAVRFFSGTPVHSLPPPERFQGAGVYALYYTGHYSLYDEYSRINRLAYNLPIYVGKAVPAGWRQSRISDHETRAGSELSNRIREHGRNIAKTSNLDLCDFSCRFVIFEATGSDMISTVQAALIKIYKPLWNTVVDGFGNHTPGAGRFAQAKSDWDVIHPGREWAEKCTGVHSEPYFIEERIKQYFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Eco29kIR
publication title Folding, DNA Recognition, and Function of GIY-YIG Endonucleases: Crystal Structures of R.Eco29kI.
pubmed doi rcsb
source organism Escherichia coli
total genus 56
structure length 208
sequence length 208
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09517 RE_Eco29kI Eco29kI restriction endonuclease
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...