3RMRA

Crystal structure of hyaloperonospora arabidopsidis atr1 effector domain
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
248
structure length
236
Chain Sequence
WPFGPSAVEALIETIDRHGRVSLNDEAKMKKVVRTWKKLIERDDLIGEIGKHYFEAPGPLHDTYDEALATRLVTTYSDRGVARAILHTRPSDPLSKKAGQAHRLEEAVASLWKGRGYTSDNVVSSIATGHDVDFFAPTAFTFLVKCVESEDDANNAIFEYFGSNPSRYFSAVLHAMEKPDADSRVLESSKKWMFQCYAQKQFPTPVFERTLAAYQYEKLSLSQIEELVEEYSRIYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Hyaloperonospora arabidopsidis ATR1 effector has distributed recognition surfaces and a structural subdomain conserved across oomycete species
rcsb
molecule tags Protein binding
source organism Hyaloperonospora parasitica
molecule keywords Avirulence protein
total genus 81
structure length 236
sequence length 248
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-04-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...