3S3CC

Structure of thermus thermophilus cytochrome ba3 oxidase 360s after xe depressurization
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
33
structure length
33
Chain Sequence
EEKPKGALAVILVLTLTILVFWLGVYAVFFARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mobility of Xe atoms within the oxygen diffusion channel of cytochrome ba(3) oxidase.
pubmed doi rcsb
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
source organism Thermus thermophilus
total genus 11
structure length 33
sequence length 33
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08113 CoxIIa Cytochrome c oxidase subunit IIa family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...