3SDPA

The 2.1 angstroms resolution structure of iron superoxide dismutase from pseudomonas ovalis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
186
structure length
186
Chain Sequence
PPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTPEFEGKTLEEIVKSSSGGIFNNAAQVWNHTFYWNCLSPDAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWAWLVKADGSLALCSTIGAGAPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWNLVNWAFVAEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (superoxide acceptor)
molecule keywords IRON SUPEROXIDE DISMUTASE
publication title The 2.1-A resolution structure of iron superoxide dismutase from Pseudomonas ovalis.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 26
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1991-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...