3TQ7B

Eb1c/eb3c heterodimer in complex with the cap-gly domain of p150glued
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
55
Chain Sequence
ELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHPVISGIIGILYATEQDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interaction of mammalian end binding proteins with CAP-Gly domains of CLIP-170 and p150(glued).
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Microtubule-associated protein RP/EB family member 1
total genus 21
structure length 55
sequence length 78
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03271 EB1 EB1-like C-terminal motif
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...