The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
115
|
structure length |
115
|
Chain Sequence |
HNLLIFCLKDNVSISEYTEMIDWAYKNIQSETVVEITENQIIEYQNRGLWRLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTEPLVKNIIHVLEYAIKNEKTVIFHF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Neisseria conserved hypothetical protein DMP12 is a DNA mimic that binds to histone-like HU protein
pubmed doi rcsb |
| molecule tags |
Protein binding
|
| source organism |
Neisseria meningitidis mc58
|
| molecule keywords |
DNA mimic protein DMP12
|
| total genus |
37
|
| structure length |
115
|
| sequence length |
115
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2012-11-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF16779 | DMP12 | DNA-mimic protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Hypothetical protein yfbM fold | Hypothetical protein yfbM fold |
#chains in the Genus database with same CATH superfamily 3W1O A; #chains in the Genus database with same CATH topology 3W1O A; 1RYL A; #chains in the Genus database with same CATH homology 3W1O A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
