
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
79
|
sequence length |
228
|
structure length |
217
|
Chain Sequence |
LPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSELMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase/transferase inhibitor
|
source organism |
Escherichia coli
|
publication title |
Antibacterial drug leads targeting isoprenoid biosynthesis.
pubmed doi rcsb |
molecule keywords |
Undecaprenyl pyrophosphate synthase
|
total genus |
79
|
structure length |
217
|
sequence length |
228
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.5.1.31: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl- |
pdb deposition date | 2012-09-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01255 | Prenyltransf | Putative undecaprenyl diphosphate synthase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Undecaprenyl pyrophosphate synthetase | Decaprenyl diphosphate synthase-like |
#chains in the Genus database with same CATH superfamily 3QAS A; 4Q9M A; 5HXO A; 3WYJ A; 5HXP A; 1X06 A; 2E99 A; 1X09 A; 3SGX A; 4CMW A; 5HXQ A; 5KH5 A; 2E9C A; 3SGV A; 4KT8 A; 1UEH A; 5CQJ A; 4U82 A; 5HC7 A; 2VG4 A; 4H38 A; 4ONC A; 5KH2 A; 5KH4 A; 2D2R A; 4H2M A; 4Q9O A; 3WQK A; 3WQM A; 3WQN A; 2VG3 A; 4H2J A; 2E9D A; 3UGS A; 3SGT A; 2DTN A; 3TH8 A; 2VG1 A; 4CMX A; 1F75 A; 2E9A A; 4H3C A; 5HC8 A; 1V7U A; 4H2O A; 4H8E A; 5CQB A; 2VG0 A; 5HXT A; 4CMV A; 1X07 A; 2VFW A; 2E98 A; 3SH0 A; 5HXN A; 1X08 A; 3WQL A; 2VG2 A; 4H3A A; 3WYI A; 5HC6 A; 1JP3 A; #chains in the Genus database with same CATH topology 3QAS A; 4Q9M A; 5HXO A; 3WYJ A; 5HXP A; 1X06 A; 2E99 A; 1X09 A; 3SGX A; 4CMW A; 5HXQ A; 5KH5 A; 2E9C A; 3SGV A; 4KT8 A; 1UEH A; 5CQJ A; 4U82 A; 5HC7 A; 2VG4 A; 4H38 A; 4ONC A; 5KH2 A; 5KH4 A; 2D2R A; 4H2M A; 4Q9O A; 3WQK A; 3WQM A; 3WQN A; 2VG3 A; 4H2J A; 2E9D A; 3UGS A; 3SGT A; 2DTN A; 3TH8 A; 2VG1 A; 4CMX A; 1F75 A; 2E9A A; 4H3C A; 5HC8 A; 1V7U A; 4H2O A; 4H8E A; 5CQB A; 2VG0 A; 5HXT A; 4CMV A; 1X07 A; 2VFW A; 2E98 A; 3SH0 A; 5HXN A; 1X08 A; 3WQL A; 2VG2 A; 4H3A A; 3WYI A; 5HC6 A; 1JP3 A; #chains in the Genus database with same CATH homology 3QAS A; 4Q9M A; 5HXO A; 3WYJ A; 5HXP A; 1X06 A; 2E99 A; 1X09 A; 3SGX A; 4CMW A; 5HXQ A; 5KH5 A; 2E9C A; 3SGV A; 4KT8 A; 1UEH A; 5CQJ A; 4U82 A; 5HC7 A; 2VG4 A; 4H38 A; 4ONC A; 5KH2 A; 5KH4 A; 2D2R A; 4H2M A; 4Q9O A; 3WQK A; 3WQM A; 3WQN A; 2VG3 A; 4H2J A; 2E9D A; 3UGS A; 3SGT A; 2DTN A; 3TH8 A; 2VG1 A; 4CMX A; 1F75 A; 2E9A A; 4H3C A; 5HC8 A; 1V7U A; 4H2O A; 4H8E A; 5CQB A; 2VG0 A; 5HXT A; 4CMV A; 1X07 A; 2VFW A; 2E98 A; 3SH0 A; 5HXN A; 1X08 A; 3WQL A; 2VG2 A; 4H3A A; 3WYI A; 5HC6 A; 1JP3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...