4H4JA

Crystal structure of a n-acetylmuramoyl-l-alanine amidase (bacuni_02947) from bacteroides uniformis atcc 8492 at 1.15 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
240
structure length
236
Chain Sequence
GQGGKDMLSNGIKYLDVPYVAHTLEADGPEELVINCDEVDCTTLVEYVLAETLTPKLISESAFADNLQKIRYRDGKIDGYTSRLHYIADWINNGVRNGFLQDVTGAMSPDTERLSISYMSSHPQLYKQLANSPENVAKMKKIEQSLSGKEVHYLPKAKLPADGLPWIKDGDIIAITTNTPGLDVAHMGIAFYADNKLLLVHASSTDKKVVVSKVPLSQMLKDNNKWTGIRVLRMKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACUNI_02947) from Bacteroides uniformis ATCC 8492 at 1.15 A resolution
rcsb
molecule keywords hypothetical protein
molecule tags Structural genomics, unknown function
source organism Bacteroides uniformis
total genus 80
structure length 236
sequence length 240
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07313 DUF1460 Protein of unknown function (DUF1460)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3670.10 Mainly Alpha Orthogonal Bundle Putative xylanase fold Putative xylanase like domain 4h4jA01
2.30.260.10 Mainly Beta Roll putative xylanase like fold putative xylanase like domain 4h4jA02
2IM9A 4H4JA 2P1GA 4Q5KA 4Q68A
chains in the Genus database with same CATH superfamily
2IM9A 4H4JA 2P1GA 4Q5KA 4Q68A
chains in the Genus database with same CATH topology
2IM9A 4H4JA 2P1GA 4Q5KA 4Q68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IM9 A;  4H4J A;  2P1G A;  4Q5K A;  4Q68 A; 
#chains in the Genus database with same CATH topology
 2IM9 A;  4H4J A;  2P1G A;  4Q5K A;  4Q68 A; 
#chains in the Genus database with same CATH homology
 2IM9 A;  4H4J A;  2P1G A;  4Q5K A;  4Q68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...