The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
96
|
sequence length |
332
|
structure length |
332
|
Chain Sequence |
IMTKNQISSNYYKTVLPYKASKSRGLVVSNIYSRYDINELESGLMRVSQNKYSPDNYLFQEGQYLDKETLEKWLDRKSDKNPNGLNPASNGNGENRKPIYLAHILEQDYLKQTDKDTVALGGISIALAMNSVDYYQKEKYGDTYEQPISDSELLAQGKEMSATVLNRIRQTKGLENVPVTIAIYKQGARDAVAPGNYIAYATANGDSLSNWKDIDEKNYVLPSTESAKDHKTDNDNFLNFKKAIEDYYPNFTGVVGRGRYEDGQLAELNIDIPLQFYGEAEIIGFTQYVTDLVGQHIPKTADLQVNISTSDGPAALITRKANEDAATAHIYD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The crystal structure of a sex pheromone precursor (lmo1757) from Listeria monocytogenes EGD-e
rcsb |
| molecule keywords |
Lmo1757 protein
|
| molecule tags |
Signaling protein
|
| source organism |
Listeria monocytogenes
|
| total genus |
96
|
| structure length |
332
|
| sequence length |
332
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2012-10-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07537 | CamS | CamS sex pheromone cAM373 precursor |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | sex pheromone staph- cam373 precursor fold | sex pheromone staph- cam373 precursor domain |
#chains in the Genus database with same CATH superfamily 3N2Q A; 2QX2 A; 3IB5 A; 4HN3 A; #chains in the Genus database with same CATH topology 3N2Q A; 2QX2 A; 3IB5 A; 4HN3 A; #chains in the Genus database with same CATH homology 3N2Q A; 2QX2 A; 3IB5 A; 4HN3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...