The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
173
|
structure length |
170
|
Chain Sequence |
PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPREKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITFPIPGEPGFPLNAIYAKPNKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb |
molecule tags |
Structural protein
|
molecule keywords |
Actin-related protein 3
|
total genus |
51
|
structure length |
170
|
sequence length |
173
|
ec nomenclature | |
pdb deposition date | 2013-02-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
E | PF04062 | P21-Arc | ARP2/3 complex ARPC3 (21 kDa) subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arp2/3 complex 21 kDa subunit ARPC3 | Actin-related protein 2/3 complex subunit 3 |
#chains in the Genus database with same CATH superfamily 2P9N E; 2P9K E; 2P9U E; 4JD2 E; 1U2V E; 3UKU E; 3UKR E; 1TYQ E; 2P9I E; 3DXK E; 1K8K E; 3DXM E; 2P9P E; 3ULE E; 2P9L E; 2P9S E; 3RSE E; 4XEI E; #chains in the Genus database with same CATH topology 5JSZ C; 1U2V E; 4HUQ S; 4M5C A; 3UKR E; 2P9I E; 4DVE A; 3DXM E; 4MHW A; 2P9S E; 3RSE E; 4N4D A; 4Z7F A; 2P9N E; 2P9K E; 2P9U E; 4JD2 E; 3UKU E; 1K8K E; 2P9P E; 2P9L E; 5D3M C; 4HZU S; 4XEI E; 4TKR A; 5KBW A; 4POV A; 4RFS S; 4POP A; 5D0Y A; 4MUU A; 3ULE E; 4M5B A; 3RLB A; 5KC0 A; 5KC4 A; 1TYQ E; 3DXK E; 3P5N A; 4MES A; 4M58 A; #chains in the Genus database with same CATH homology 2P9N E; 2P9K E; 2P9U E; 4JD2 E; 1U2V E; 3UKU E; 3UKR E; 1TYQ E; 2P9I E; 3DXK E; 1K8K E; 3DXM E; 2P9P E; 3ULE E; 2P9L E; 2P9S E; 3RSE E; 4XEI E;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...