The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
110
|
sequence length |
318
|
structure length |
318
|
Chain Sequence |
PEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The structure of human alpha-2,6-sialyltransferase reveals the binding mode of complex glycans
doi rcsb |
molecule tags |
Transferase
|
source organism |
Homo sapiens
|
molecule keywords |
Beta-galactoside alpha-2,6-sialyltransferase 1
|
total genus |
110
|
structure length |
318
|
sequence length |
318
|
ec nomenclature |
ec
2.4.99.1: Beta-galactoside alpha-(2,6)-sialyltransferase. |
pdb deposition date | 2013-03-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00777 | Glyco_transf_29 | Glycosyltransferase family 29 (sialyltransferase) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | sialyltransferase cstii, chain A | sialyltransferase cstii, chain A |
#chains in the Genus database with same CATH superfamily 2WML A; 2WNB A; 4JS2 A; 5BO8 A; 4JS1 A; 5BO6 A; 5BO7 A; 2WNF A; 5BO9 A; 5CXY A; 4MPS A; #chains in the Genus database with same CATH topology 2X61 A; 4JS2 A; 2WQQ A; 2X63 A; 2WNF A; 5CXY A; 5BO6 A; 2P56 A; 2P2V A; 2WML A; 2WNB A; 5BO8 A; 4JS1 A; 2X62 A; 5BO9 A; 1RO7 A; 1RO8 A; 5BO7 A; 4MPS A; 2DRJ A; #chains in the Genus database with same CATH homology 2WML A; 2WNB A; 4JS2 A; 5BO8 A; 4JS1 A; 5BO6 A; 5BO7 A; 2WNF A; 5BO9 A; 5CXY A; 4MPS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...