The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
82
|
sequence length |
227
|
structure length |
227
|
Chain Sequence |
MHIPEGYLSPQTCAVMGAAMVPVLTVAAKKVNKSFDKKDVPAMAIGSAFAFTIMMFNVPIPGGTTAHAIGATLLATTLGPWAASISLTLALFIQALLFGDGGILALGANSFNMAFIAPFVGYGIYRLMLSLKLNKVLSSAIGGYVGINAAALATAIELGLQPLLFHTANGTPLYFPYGLNVAIPAMMFAHLTVAGIVEAVITGLVVYYLQKVDEENILHKFSYRLRG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Planar substrate-binding site dictates the specificity of ECF-type nickel/cobalt transporters
pubmed doi rcsb |
molecule tags |
Membrane protein
|
source organism |
Thermoanaerobacter tengcongensis
|
molecule keywords |
Cobalamin biosynthesis protein CbiM
|
total genus |
82
|
structure length |
227
|
sequence length |
227
|
ec nomenclature | |
pdb deposition date | 2013-08-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01891 | CbiM | Cobalt uptake substrate-specific transmembrane region |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arp2/3 complex 21 kDa subunit ARPC3 | Arp2/3 complex 21 kDa subunit ARPC3 |
#chains in the Genus database with same CATH superfamily 3RLB A; 4POP A; 5KC4 A; 4RFS S; 4TKR A; 4POV A; 5D0Y A; 5KC0 A; 4N4D A; 5D3M C; 4Z7F A; 4MES A; 5KBW A; 4M5B A; 4M5C A; 4MHW A; 3P5N A; 4HZU S; 4HUQ S; 4DVE A; 5JSZ C; 4M58 A; 4MUU A; #chains in the Genus database with same CATH topology 3RLB A; 4POP A; 1U2V E; 5KC4 A; 4RFS S; 2P9K E; 4TKR A; 2P9P E; 4POV A; 4MUU A; 1TYQ E; 5D0Y A; 4JD2 E; 1K8K E; 2P9S E; 5KC0 A; 3DXK E; 4N4D A; 2P9L E; 5D3M C; 2P9N E; 4Z7F A; 4MES A; 5KBW A; 3DXM E; 2P9U E; 4M5B A; 4M5C A; 4XEI E; 3UKR E; 3P5N A; 3ULE E; 4HZU S; 2P9I E; 3RSE E; 4HUQ S; 3UKU E; 4DVE A; 5JSZ C; 4M58 A; 4MHW A; #chains in the Genus database with same CATH homology 3RLB A; 4POP A; 5KC4 A; 4RFS S; 4TKR A; 4POV A; 5D0Y A; 5KC0 A; 4N4D A; 5D3M C; 4Z7F A; 4MES A; 5KBW A; 4M5B A; 4M5C A; 4MHW A; 3P5N A; 4HZU S; 4HUQ S; 4DVE A; 5JSZ C; 4M58 A; 4MUU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...