The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
97
|
structure length |
97
|
Chain Sequence |
MKVTYSGSDSKTYDGNPANFEPTTVQWSGLKGLNTSTLTSADFTWNTADKKAPTDAGKYTLSLNTTGEAALRKANPNYDLKTISGSYTYTINPLGID
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural and molecular insights into novel surface-exposed mucus adhesins from Lactobacillus reuteri human strains.
pubmed doi rcsb |
molecule tags |
Cell adhesion
|
source organism |
Lactobacillus reuteri
|
molecule keywords |
LAR_0958 cell surface adhesin
|
total genus |
23
|
structure length |
97
|
sequence length |
97
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2013-11-01 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Ribosomal Protein L9; domain 2 | Ribosomal Protein L9; domain 2 |
#chains in the Genus database with same CATH superfamily 4NG0 A; #chains in the Genus database with same CATH topology 1DIV A; 4NG0 A; #chains in the Genus database with same CATH homology 4NG0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...