The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
72
|
sequence length |
363
|
structure length |
313
|
Chain Sequence |
MAGNSIGQLFRVTTCGESHGVGLMAIVDGVPPGLALTEEDLQKDLDRRKPGTSKFATQRKEPDQVEIISGVFEGKTTGTPIGLLIRNTDQKGGGRSSARETAMRVAAGAIAKKYLAEKFGVLIRGHVTQIGNEVAEKLDWNEVPNNPFFCGDVDAVPRFEALVTSLREQGTSCGAKLEILAEKVPVGWGEPVFDRLDADIAHAMMSINAVKGVEIGDGFAVAGQFGHETRDELTSHGFLANHAGGILGGISSGQTIRVAIALKPTAKGRHDPCVGVRATPIAEAMLAIVLMDHFLRHRAQNADVVPPFAPIEP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of chorismate synthase from Acinetobacter baumannii at 2.50A resolution
rcsb |
molecule tags |
Lyase
|
source organism |
Acinetobacter baumannii
|
molecule keywords |
Chorismate synthase
|
total genus |
72
|
structure length |
313
|
sequence length |
363
|
chains with identical sequence |
B
|
ec nomenclature |
ec
4.2.3.5: Chorismate synthase. |
pdb deposition date | 2014-01-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01264 | Chorismate_synt | Chorismate synthase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 4-Layer Sandwich | Chorismate synthase, AroC fold | Chorismate synthase AroC |
#chains in the Genus database with same CATH superfamily 1R53 A; 4ECD A; 1UM0 A; 2QHF A; 1Q1L A; 2O12 A; 1SQ1 A; 1R52 A; 2G85 A; 2O11 A; 1QXO A; 4OB9 A; 4BAJ A; 4LJ2 A; 4O90 A; 4BAI A; 1ZTB A; 1UMF A; #chains in the Genus database with same CATH topology 1R53 A; 4ECD A; 1UM0 A; 2QHF A; 1Q1L A; 2O12 A; 1SQ1 A; 1R52 A; 2G85 A; 2O11 A; 1QXO A; 4OB9 A; 4BAJ A; 4LJ2 A; 4O90 A; 4BAI A; 1ZTB A; 1UMF A; #chains in the Genus database with same CATH homology 1R53 A; 4ECD A; 1UM0 A; 2QHF A; 1Q1L A; 2O12 A; 1SQ1 A; 1R52 A; 2G85 A; 2O11 A; 1QXO A; 4OB9 A; 4BAJ A; 4LJ2 A; 4O90 A; 4BAI A; 1ZTB A; 1UMF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...