The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
70
|
structure length |
70
|
Chain Sequence |
MAKEFGIPAAVAKTVLNVVEAGGWVTTIVSILTAVGSGGKSLLAAAGRESIKAYLKKEIKKKGKRAVIAW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The bacteriocin AS-48 requires dimer dissociation followed by hydrophobic interactions with the membrane for antibacterial activity.
pubmed doi rcsb |
molecule tags |
Antibiotic
|
source organism |
Enterococcus faecalis
|
molecule keywords |
Bacteriocin AS-48
|
total genus |
26
|
structure length |
70
|
sequence length |
70
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2014-09-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09221 | Bacteriocin_IId | Bacteriocin class IId cyclical uberolysin-like |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Bacteriocin As-48; Chain A | Bacteriocin AS-48 |
#chains in the Genus database with same CATH superfamily 4RGD A; 2MP8 A; 2KJF A; 1E68 A; 1O83 A; 1O84 A; 1O82 A; #chains in the Genus database with same CATH topology 3W9Z A; 4RGD A; 2KJF A; 2MP8 A; 2KSN A; 1E68 A; 4YCP A; 1O83 A; 4YCO A; 4BF9 A; 1O84 A; 1O82 A; 4BFA A; #chains in the Genus database with same CATH homology 4RGD A; 2MP8 A; 2KJF A; 1E68 A; 1O83 A; 1O84 A; 1O82 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...