The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
151
|
structure length |
151
|
Chain Sequence |
YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the YTH domain of YTHDF2 reveals mechanism for recognition of N6-methyladenosine.
pubmed doi rcsb |
molecule tags |
Rna binding protein
|
source organism |
Homo sapiens
|
molecule keywords |
YTH domain-containing family protein 2
|
total genus |
44
|
structure length |
151
|
sequence length |
151
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2014-10-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04146 | YTH | YT521-B-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | ph1033 like fold | ph1033 like domains |
#chains in the Genus database with same CATH superfamily 4RDN A; 4RCJ A; 2ZBN A; 5J3E A; 5DNO A; 4RDO A; 1WMM A; 2AR1 A; 4RCI A; 1ZCE A; 2P5D A; 2YU6 A; 2G2X A; 3EOP A; 4RCM A; 4U8T A; 2HD9 A; 4WQN A; 2EVE A; 2YUD A; 2GBS A; #chains in the Genus database with same CATH topology 4RDN A; 4RCJ A; 2ZBN A; 5J3E A; 5DNO A; 4RDO A; 1WMM A; 2AR1 A; 4RCI A; 1ZCE A; 2P5D A; 2YU6 A; 2G2X A; 3EOP A; 4RCM A; 4U8T A; 2HD9 A; 4WQN A; 2EVE A; 2YUD A; 2GBS A; #chains in the Genus database with same CATH homology 4RDN A; 4RCJ A; 2ZBN A; 5J3E A; 5DNO A; 4RDO A; 1WMM A; 2AR1 A; 4RCI A; 1ZCE A; 2P5D A; 2YU6 A; 2G2X A; 3EOP A; 4RCM A; 4U8T A; 2HD9 A; 4WQN A; 2EVE A; 2YUD A; 2GBS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...