The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
160
|
structure length |
160
|
Chain Sequence |
AMQFDVTIEIPKGQRNKYEVDHETGRVRLDRYLYTPMAYPTDYGFIEDTLGDDGDPLDALVLLPQPVFPGVLVAARPVGMFRMVDEHGGDDKVLCVPAGDPRWDHVQDIGDVPAFELDAIKHFFVHYKDLEPGKFVKAADWVDRAEAEAEVQRSVERFKA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and computational dissection of the catalytic mechanism of the inorganic pyrophosphatase from Mycobacterium tuberculosis.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
|
| molecule keywords |
Inorganic pyrophosphatase
|
| total genus |
41
|
| structure length |
160
|
| sequence length |
160
|
| chains with identical sequence |
B, C, D, E, F, G, H, I, J, K, L
|
| ec nomenclature |
ec
3.6.1.1: Inorganic diphosphatase. |
| pdb deposition date | 2015-04-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00719 | Pyrophosphatase | Inorganic pyrophosphatase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Inorganic Pyrophosphatase | Inorganic pyrophosphatase |
#chains in the Genus database with same CATH superfamily 3I98 A; 4LUG A; 3LO0 A; 2BQY A; 4Z72 A; 3LD3 A; 2AU7 A; 1MJY A; 3EIY A; 4Z74 A; 3EJ0 A; 2IK1 A; 1WCF A; 2BQX A; 3SW5 A; 2IK2 A; 2AU6 A; 3R5V A; 3Q5V A; 2PRD A; 4UM4 A; 1UDE A; 2IK9 A; 117E A; 1E6A A; 1M38 A; 1SXV A; 2UXS A; 1INO A; 4Z70 A; 1IPW A; 1YGZ A; 5KDF A; 1MJX A; 2IK7 A; 1E9G A; 3EIZ A; 2IK6 A; 1MJW A; 5TEA A; 1HUJ A; 1JFD A; 8PRK A; 1IGP A; 2IK4 A; 3R6E A; 1WGJ A; 3I4Q A; 1TWL A; 3GVF A; 1PYP A; 2AUU A; 3R5U A; 3FQ3 A; 2EIP A; 3EJ2 A; 1MJZ A; 2AU9 A; 3D63 A; 4QLZ A; 1FAJ A; 4Z71 A; 3Q4W A; 3TR4 A; 5H4F A; 4QMB A; 1OBW A; 3D53 A; 2IHP A; 3Q46 A; 4ECP A; 4XEL A; 1HUK A; 1YPP A; 4Z73 A; 2AU8 A; 2IK0 A; 5KDE A; 1I6T A; 1WGI A; 3EMJ A; 1QEZ A; 1I40 A; 3Q3L A; #chains in the Genus database with same CATH topology 3I98 A; 4LUG A; 3LO0 A; 2BQY A; 4Z72 A; 3LD3 A; 2AU7 A; 1MJY A; 3EIY A; 4Z74 A; 3EJ0 A; 2IK1 A; 1WCF A; 2BQX A; 3SW5 A; 2IK2 A; 2AU6 A; 3R5V A; 3Q5V A; 2PRD A; 4UM4 A; 1UDE A; 2IK9 A; 117E A; 1E6A A; 1M38 A; 1SXV A; 2UXS A; 1INO A; 4Z70 A; 1IPW A; 1YGZ A; 5KDF A; 1MJX A; 2IK7 A; 1E9G A; 3EIZ A; 2IK6 A; 1MJW A; 5TEA A; 1HUJ A; 1JFD A; 8PRK A; 1IGP A; 2IK4 A; 3R6E A; 1WGJ A; 3I4Q A; 1TWL A; 3GVF A; 1PYP A; 2AUU A; 3R5U A; 3FQ3 A; 2EIP A; 3EJ2 A; 1MJZ A; 2AU9 A; 3D63 A; 4QLZ A; 1FAJ A; 4Z71 A; 3Q4W A; 3TR4 A; 5H4F A; 4QMB A; 1OBW A; 3D53 A; 2IHP A; 3Q46 A; 4ECP A; 4XEL A; 1HUK A; 1YPP A; 4Z73 A; 2AU8 A; 2IK0 A; 5KDE A; 1I6T A; 1WGI A; 3EMJ A; 1QEZ A; 1I40 A; 3Q3L A; #chains in the Genus database with same CATH homology 3I98 A; 4LUG A; 3LO0 A; 2BQY A; 4Z72 A; 3LD3 A; 2AU7 A; 1MJY A; 3EIY A; 4Z74 A; 3EJ0 A; 2IK1 A; 1WCF A; 2BQX A; 3SW5 A; 2IK2 A; 2AU6 A; 3R5V A; 3Q5V A; 2PRD A; 4UM4 A; 1UDE A; 2IK9 A; 117E A; 1E6A A; 1M38 A; 1SXV A; 2UXS A; 1INO A; 4Z70 A; 1IPW A; 1YGZ A; 5KDF A; 1MJX A; 2IK7 A; 1E9G A; 3EIZ A; 2IK6 A; 1MJW A; 5TEA A; 1HUJ A; 1JFD A; 8PRK A; 1IGP A; 2IK4 A; 3R6E A; 1WGJ A; 3I4Q A; 1TWL A; 3GVF A; 1PYP A; 2AUU A; 3R5U A; 3FQ3 A; 2EIP A; 3EJ2 A; 1MJZ A; 2AU9 A; 3D63 A; 4QLZ A; 1FAJ A; 4Z71 A; 3Q4W A; 3TR4 A; 5H4F A; 4QMB A; 1OBW A; 3D53 A; 2IHP A; 3Q46 A; 4ECP A; 4XEL A; 1HUK A; 1YPP A; 4Z73 A; 2AU8 A; 2IK0 A; 5KDE A; 1I6T A; 1WGI A; 3EMJ A; 1QEZ A; 1I40 A; 3Q3L A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
