The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
48
|
sequence length |
168
|
structure length |
163
|
Chain Sequence |
GTKSIALMGVLIAVVVVFSRFFAYETTFLKISFTFIPESLIGMIFGPFWAGIGTAVADVVGMLLFPKAGYFPGFTLNAFLAGAIYGYFYYKKEMTWQRVILATLLVTVLINIILTPLWLSLMYGVNLANFAWWVPRLIKTVIFFPIQVIATYYLGNKLFGKPL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structures of FolT in substrate-bound and substrate-released conformations reveal a gating mechanism for ECF transporters
pubmed doi rcsb |
| molecule keywords |
Folate ECF transporter
|
| molecule tags |
Transport protein
|
| source organism |
Enterococcus faecalis (strain atcc 700802 / v583)
|
| total genus |
48
|
| structure length |
163
|
| sequence length |
168
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature | |
| pdb deposition date | 2015-04-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF12822 | ECF_trnsprt | ECF transporter, substrate-specific component |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arp2/3 complex 21 kDa subunit ARPC3 | Arp2/3 complex 21 kDa subunit ARPC3 |
#chains in the Genus database with same CATH superfamily 5KC0 A; 4MUU A; 4RFS S; 4TKR A; 4MHW A; 4POV A; 4HUQ S; 4M5C A; 4M5B A; 5D0Y A; 5KBW A; 4N4D A; 4M58 A; 4POP A; 4HZU S; 3RLB A; 4Z7F A; 4DVE A; 5JSZ C; 4MES A; 5D3M C; 3P5N A; 5KC4 A; #chains in the Genus database with same CATH topology 2P9L E; 1U2V E; 3DXK E; 5KC0 A; 4MUU A; 4RFS S; 4TKR A; 2P9I E; 3UKU E; 4MHW A; 3DXM E; 1TYQ E; 4POV A; 4HUQ S; 4M5C A; 3RSE E; 4M5B A; 5D0Y A; 2P9P E; 5KBW A; 4N4D A; 4M58 A; 2P9K E; 3UKR E; 4POP A; 4HZU S; 1K8K E; 2P9S E; 3RLB A; 4Z7F A; 2P9U E; 4DVE A; 2P9N E; 5JSZ C; 4MES A; 5D3M C; 4XEI E; 3P5N A; 3ULE E; 5KC4 A; 4JD2 E; #chains in the Genus database with same CATH homology 5KC0 A; 4MUU A; 4RFS S; 4TKR A; 4MHW A; 4POV A; 4HUQ S; 4M5C A; 4M5B A; 5D0Y A; 5KBW A; 4N4D A; 4M58 A; 4POP A; 4HZU S; 3RLB A; 4Z7F A; 4DVE A; 5JSZ C; 4MES A; 5D3M C; 3P5N A; 5KC4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...