4CADC

Mechanism of farnesylated caax protein processing by the integral membrane protease rce1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
251
Chain Sequence
NPKLYFLSTFVVTYILWFTGAYLSFSSTYSGIYMLIMLPGLMAPFIISTILIAKKKDFINRLFNLKLINLKTIPVVFLLMPAVILLSILLSIPFGGSISQFQFSGGDFVPVLFLLLLAATFEELGWRGYAFDSLQSRYSLFKASILFGIFWSLWHFPLIFVNNSYQYEIFNQSIWYGLNFFLSILPMGIIITWMCLKNRKSIILAIIFHFLINLNQELLAITQDTKIIETGVLFLVAAAIILYDKKMFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Farnesylated Caax Protein Processing by the Intramembrane Protease Rce1
pubmed doi rcsb
molecule tags Protein binding
source organism Methanococcus maripaludis
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
total genus 95
structure length 251
sequence length 262
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02517 CPBP CPBP intramembrane metalloprotease
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...