4CSFE

Structural insights into toscana virus rna encapsidation
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
ENYRDIALAFLDESADSGTINAWVNEFAYEGFDPKRIVQLVKERGTAKGRDWKKDVKMMIVLNLVRGNKPEAMMKKMSEKGASIVANLISVYQLKEGNPGRDTITLSRVSAAFVPWTVQALRVLSESLPVSGTTMDAIAGVTYPRAMMHPSFAGIIDLDLPNGAGATIADAHGLFMIEFSKTINPSLRTKQANEVAATFEKPNMAAMSGRFFTREDKKKLLIAVGIIDEDLVLASAVVRSAEKYRAKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/rna
molecule keywords NUCLEOPROTEIN
publication title Structural Insights Into RNA Encapsidation and Helical Assembly of the Toscana Virus Nucleoprotein.
pubmed doi rcsb
source organism Toscana virus
total genus 82
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05733 Tenui_N Tenuivirus/Phlebovirus nucleocapsid protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...