4E0EA

Crystal structure of a duf4450 family protein (bt_4147) from bacteroides thetaiotaomicron vpi-5482 at 2.90 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
169
structure length
169
Chain Sequence
AQQLTPPAGTFRLGISKGTDSHWLAPQEKVKGIAFRWKALPDTRGFILEVAVTSLQQADTLFWSFGNCQPDMDINVFSVEGQAFTCYYGESMKLRTLQAVTPTDDIRLSNGRQDKTPLLLYESGKRTDRPVLAGRCPLAANSKLYFCFYEQNARADYNYFMLPDLFAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BT_4147) from Bacteroides thetaiotaomicron VPI-5482 at 2.90 A resolution
rcsb
molecule keywords Putative uncharacterized protein
molecule tags Unknown function
source organism Bacteroides thetaiotaomicron
total genus 30
structure length 169
sequence length 169
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14614 DUF4450 Domain of unknown function (DUF4450)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...