The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
5
|
sequence length |
45
|
structure length |
45
|
Chain Sequence |
SGNTGSIINNYYMQQYQNSMDTQLNDWFSKLASSAFSGLFGALLA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Perturbations in the surface structure of A22 Iraq foot-and-mouth disease virus accompanying coupled changes in host cell specificity and antigenicity.
pubmed rcsb |
| molecule tags |
Virus
|
| molecule keywords |
capsid protein VP1
|
| total genus |
5
|
| structure length |
45
|
| sequence length |
45
|
| ec nomenclature | |
| pdb deposition date | 2012-08-07 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Foot-And-Mouth Disease Virus, subunit 4 | Capsid protein VP4 superfamily, Picornavirus |
#chains in the Genus database with same CATH superfamily 1ZBE 4; 1MEC 4; 2MEV 4; 1BBT 4; 2WZR 4; 5D8A D; 4IV1 D; 1FOD 4; 5DDJ 4; 5AC9 4; 1ZBA 4; 1QQP 4; 1FMD 4; 4GH4 D; 5ACA 4; #chains in the Genus database with same CATH topology 1ZBE 4; 1MEC 4; 2MEV 4; 1BBT 4; 2WZR 4; 5D8A D; 4IV1 D; 1FOD 4; 5DDJ 4; 5AC9 4; 1ZBA 4; 1QQP 4; 1FMD 4; 4GH4 D; 5ACA 4; #chains in the Genus database with same CATH homology 1ZBE 4; 1MEC 4; 2MEV 4; 1BBT 4; 2WZR 4; 5D8A D; 4IV1 D; 1FOD 4; 5DDJ 4; 5AC9 4; 1ZBA 4; 1QQP 4; 1FMD 4; 4GH4 D; 5ACA 4;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
