The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
143
|
structure length |
143
|
Chain Sequence |
MLKKWEHYEHTADIGIRGYGDSLEEAFEAVAIALFDVMVNVNKVEKKEVREIEVEAEDLEALLYSFLEELLVIHDIEGLVFRDFEVKIERVNGKYRLRAKAYGEKLDLKKHEPKEEVKAITYHDMKIERLPNGKWMAQLVPDI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A tRNA splicing operon: Archease endows RtcB with dual GTP/ATP cofactor specificity and accelerates RNA ligation.
pubmed doi rcsb |
molecule tags |
Chaperone
|
source organism |
Pyrococcus horikoshii
|
molecule keywords |
Protein archease
|
total genus |
32
|
structure length |
143
|
sequence length |
143
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2013-10-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01951 | Archease | Archease protein family (MTH1598/TM1083) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(bab) Sandwich | Archease, Possible Chaperone; Chain: A; domain 1 | Archease domain |
#chains in the Genus database with same CATH superfamily 1J5U A; 4N2P A; 1JW3 A; #chains in the Genus database with same CATH topology 1J5U A; 4N2P A; 1JW3 A; #chains in the Genus database with same CATH homology 1J5U A; 4N2P A; 1JW3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...