The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
70
|
sequence length |
178
|
structure length |
178
|
Chain Sequence |
KFNVRLLTEIAFMAALAFIISLIPNTVYGWIIVEIACIPILLLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQAFLEYLVAPVSLGIAGLFRQKTAPLKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQYAWKGWGAVAYSLAVNGISGILTAIAAFVILIIFVKKFPKLFIHSNY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure-Based Design of Potent Small-Molecule Binders to the S-Component of the ECF Transporter for Thiamine.
pubmed doi rcsb |
molecule tags |
Protein binding
|
source organism |
Lactococcus lactis subsp. cremoris
|
molecule keywords |
Thiamine transporter ThiT
|
total genus |
70
|
structure length |
178
|
sequence length |
178
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2014-02-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09515 | Thia_YuaJ | Thiamine transporter protein (Thia_YuaJ) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arp2/3 complex 21 kDa subunit ARPC3 | Arp2/3 complex 21 kDa subunit ARPC3 |
#chains in the Genus database with same CATH superfamily 4TKR A; 5D0Y A; 4HZU S; 4MUU A; 4MES A; 4M5C A; 5KC0 A; 4POV A; 5KBW A; 4DVE A; 4M58 A; 4M5B A; 4Z7F A; 4N4D A; 4RFS S; 4MHW A; 3P5N A; 3RLB A; 4POP A; 5KC4 A; 4HUQ S; 5D3M C; 5JSZ C; #chains in the Genus database with same CATH topology 4TKR A; 5D0Y A; 4HZU S; 3RSE E; 4MUU A; 4XEI E; 4MES A; 4M5C A; 3UKR E; 5KC0 A; 3ULE E; 2P9K E; 4POV A; 3DXK E; 5KBW A; 4DVE A; 4M58 A; 4JD2 E; 3UKU E; 4M5B A; 2P9S E; 4Z7F A; 2P9U E; 4N4D A; 4RFS S; 1U2V E; 4MHW A; 2P9P E; 3P5N A; 1TYQ E; 4POP A; 3RLB A; 5KC4 A; 2P9N E; 4HUQ S; 2P9L E; 5D3M C; 3DXM E; 2P9I E; 1K8K E; 5JSZ C; #chains in the Genus database with same CATH homology 4TKR A; 5D0Y A; 4HZU S; 4MUU A; 4MES A; 4M5C A; 5KC0 A; 4POV A; 5KBW A; 4DVE A; 4M58 A; 4M5B A; 4Z7F A; 4N4D A; 4RFS S; 4MHW A; 3P5N A; 3RLB A; 4POP A; 5KC4 A; 4HUQ S; 5D3M C; 5JSZ C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...