4Q6VA

Lpob c-terminal domain from salmonella enterica (sel-met)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
YDWNGAMQPLVSKMLQADGVTAGSVLLVDSVNNRTNGSLNANEATETLRNALANNGKFTLVSVQQLSMAKQQLGLSPQDSLGTRSKAIGIARNVGAQYVLYSSASGNVNAPALQMQLMLVQTGEIIWSGKGAVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Lipoprotein Outer Membrane Regulator of Penicillin-binding Protein 1B.
pubmed doi rcsb
molecule tags Protein binding
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule keywords Penicillin-binding protein activator LpoB
total genus 33
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2014-04-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...