4V0UD

The crystal structure of ternary pp1g-ppp1r15b and g-actin complex
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
294
Chain Sequence
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
molecule tags Motor protein/hydrolase
source organism Mus musculus
molecule keywords ACTIN, ALPHA SKELETAL MUSCLE
total genus 109
structure length 294
sequence length 294
chains with identical sequence F, H, J, N
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00149 Metallophos Calcineurin-like phosphoesterase
D PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...