4V4NAd

Structure of the methanococcus jannaschii ribosome-secyebeta channel complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MKPMYRSRSWRRKYVRTPGGRVVIHFERKKPKIAHCAMCGRPLNGIPRGRPVEMRKLPKTKKRPERPMPHLCPRCMRKVMKEQIRAQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the SecY channel during initiation of protein translocation.
pubmed doi rcsb
molecule keywords Preprotein translocase subunit SecE
molecule tags Ribosome/protein transport
source organism Methanococcus jannaschii
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-06-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...