4V6UBE

Promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
186
structure length
186
Chain Sequence
MAVEIPNKEQILADWEAHPMRRPRIEKVTINIGVGESGERLTKAEIMLQQLTGQKPIRRKAKKTNRDFGIRRGEPIAVKVTLRGPKAYELLKRLLAAVDNRLKASSFDEHGNVCFGIEEHINIPGVEYDPEIGIFGMDVCVTLERPGFRVARRKRKRAKIPTRHKLTKEEGMVYMMEEFGVEIVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 30S ribosomal protein S15P/S13e
total genus 25
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BE PF00281 Ribosomal_L5 Ribosomal protein L5
BE PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...