4V6WAN

Structure of the d. melanogaster 80s ribosome
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
GRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRKHLERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the human and Drosophila 80S ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords Elongation factor 2
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AN PF00312 Ribosomal_S15 Ribosomal protein S15
AN PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...