4V8MBL

High-resolution cryo-electron microscopy structure of the trypanosoma brucei ribosome
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
169
structure length
169
Chain Sequence
ANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARLTVRTFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFSDTGSFGFGISEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRRVSRVGFNHRVRKEEAMKWFEKVHDGIIFQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 40S RIBOSOMAL PROTEIN S3A, PUTATIVE
total genus 42
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BL PF00281 Ribosomal_L5 Ribosomal protein L5
BL PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...