4V8Tm

Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-Em Structures of Arx1 and Maturation Factors Rei1 and Jjj1 Bound to the 60S Ribosomal Subunit
pubmed doi rcsb
molecule keywords 60S RIBOSOMAL PROTEIN L2-B
molecule tags Ribosome
source organism Saccharomyces cerevisiae
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
m PF00240 ubiquitin Ubiquitin family
m PF01020 Ribosomal_L40e Ribosomal L40e family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...