4V8UBH

Crystal structure of 70s ribosome with both cognate trnas in the e and p sites representing an authentic elongation complex.
Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
166
structure length
166
Chain Sequence
PKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (12-15)S2 (23-27)TIV2 (20-23)TI1 (28-31)S3 (32-36)AH1 (59-77)S8 (121-124)TII1 (118-121)TI2 (77-80)AH2 (139-151)TIV6 (78-81)S5 (94-96)S4 (86-90)TIV8 (91-94)S6 (102-107)TI3 (127-130)TIV10 (109-112)TIV11 (125-128)S9 (130-135)TIV12 (135-138)TIV5 (47-50)TIV9 (98-101)S7 (113-116)TIV4 (46-49)Updating...
connected with : NaN
publication title Crystal structure of 70S ribosome with both cognate tRNAs in the E and P sites representing an authentic elongation complex.
pubmed doi rcsb
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
total genus 24
structure length 166
sequence length 166
chains with identical sequence DH
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BH PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.