4V99A1

The crystallographic structure of panicum mosaic virus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
217
Chain Sequence
RRRARGKSVERGSTPLQYVTTLGPSRPRMGQGQGWQKLSHEEIILQVNSSTAADTIQTIPIIPRLSVPAGDKPIYSGSAPHLRTIGSAFAIHRWRALSFEWIPSCPTTTPGNLVLRFYPNYSTETPKTLTDLMDSESLVLVPSLSGKTYRPKIETRGNPPELRNIDATAFSALSDEDKGDYSVGRLVVGSSKQAVVIQLGLLRMRYSAEMRGATSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of Panicum Mosaic Virus (PMV).
pubmed doi rcsb
molecule tags Virus/rna
molecule keywords Capsid protein
total genus 42
structure length 217
sequence length 217
chains with identical sequence A4, A5, A6, AA, AB, AC, AF, AG, AH, AK, AL, AM, AP, AQ, AR, AU, AV, AW, AZ, Aa, Ab, Ae, Af, Ag, Aj, Ak, Al, Ao, Ap, Aq, At, Au, Av, Ay, Az, B1, B4, B5, B6, BA, BB, BC, BF, BG, BH, BK, BL, BM, BP, BQ, BR, BU, BV, BW, BZ, Ba, Bb, Be, Bf, Bg, Bj, Bk, Bl, Bo, Bp, Bq, Bt, Bu, Bv, By, Bz, C1, C4, C5, C6, CA, CB, CC, CF, CG, CH, CK, CL, CM, CP, CQ, CR, CU, CV, CW, CZ, Ca, Cb, Ce, Cf, Cg, Cj, Ck, Cl, Co, Cp, Cq, Ct, Cu, Cv, Cy, Cz, D1, D4, D5, D6, DA, DB, DC, DF, DG, DH, DK, DL, DM, DP, DQ, DR, DU, DV, DW, DZ, Da, Db, De, Df, Dg, Dj, Dk, Dl, Do, Dp, Dq, Dt, Du, Dv, Dy, Dz, E1, E4, E5, E6, EA, EB, EC, EF, EG, EH, EK, EL, EM, EP, EQ, ER, EU, EV, EW, EZ, Ea, Eb, Ee, Ef, Eg, Ej, Ek, El, Eo, Ep, Eq, Et, Eu, Ev, Ey, Ez, F1, F4, F5, F6, FA, FB, FC, FF, FG, FH, FK, FL, FM, FP, FQ, FR, FU, FV, FW, FZ, Fa, Fb, Fe, Ff, Fg, Fj, Fk, Fl, Fo, Fp, Fq, Ft, Fu, Fv, Fy, Fz, G1, G4, G5, G6, GA, GB, GC, GF, GG, GH, GK, GL, GM, GP, GQ, GR, GU, GV, GW, GZ, Ga, Gb, Ge, Gf, Gg, Gj, Gk, Gl, Go, Gp, Gq, Gt, Gu, Gv, Gy, Gz, H1, H4, H5, H6, HA, HB, HC, HF, HG, HH, HK, HL, HM, HP, HQ, HR, HU, HV, HW, HZ, Ha, Hb, He, Hf, Hg, Hj, Hk, Hl, Ho, Hp, Hq, Ht, Hu, Hv, Hy, Hz, I1, I4, I5, I6, IA, IB, IC, IF, IG, IH, IK, IL, IM, IP, IQ, IR, IU, IV, IW, IZ, Ia, Ib, Ie, If, Ig, Ij, Ik, Il, Io, Ip, Iq, It, Iu, Iv, Iy, Iz, J1, J4, J5, J6, JA, JB, JC, JF, JG, JH, JK, JL, JM, JP, JQ, JR, JU, JV, JW, JZ, Ja, Jb, Je, Jf, Jg, Jj, Jk, Jl, Jo, Jp, Jq, Jt, Ju, Jv, Jy, Jz
ec nomenclature
pdb deposition date 2012-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A1 PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...