4V9LBY

70s ribosome translocation intermediate fa-3.6a containing elongation factor efg/fusidic acid/gdp, mrna, and trna bound in the pe*/e state.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
107
structure length
107
Chain Sequence
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 30S ribosomal protein S2
total genus 4
structure length 107
sequence length 107
chains with identical sequence DY
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BY PF00467 KOW KOW motif
BY PF17136 ribosomal_L24 Ribosomal proteins 50S L24/mitochondrial 39S L24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...