The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
61
|
sequence length |
177
|
structure length |
176
|
Chain Sequence |
MVVSIIPQFPDIKVSLALFEQVKNAKEIRSKMSELSTSFAFIDPRLVCSGEQMYSAIYKTLIEVKYNKMRTRNLNSECVLLSPTSNISDAFLKFGIKDDSSQLICLKFHTNTDDVDKEQLRTIMTSIVKGQEIEFNDDNLSRFYDEALIRKIYKLSDDFKPQDVNGLSRALVDAIQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structures of the Gon7/Pcc1 and Bud32/Cgi121 complexes provide a model for the complete yeast KEOPS complex.
pubmed doi rcsb |
| molecule tags |
Protein binding
|
| source organism |
Saccharomyces cerevisiae (strain atcc 204508 / s288c)
|
| molecule keywords |
EKC/KEOPS complex subunit CGI121
|
| total genus |
61
|
| structure length |
176
|
| sequence length |
177
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2014-12-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08617 | CGI-121 | Kinase binding protein CGI-121 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | PF0523-like | CGI121/TPRKB |
#chains in the Genus database with same CATH superfamily 4WW5 B; 2K8Y A; 3ENH C; 4WW9 B; 3ENP A; 4XAH A; 4WW7 B; 4WWA B; 1ZD0 A; #chains in the Genus database with same CATH topology 4WW5 B; 2K8Y A; 3ENH C; 4WW9 B; 3ENP A; 4XAH A; 4WW7 B; 4WWA B; 1ZD0 A; #chains in the Genus database with same CATH homology 4WW5 B; 2K8Y A; 3ENH C; 4WW9 B; 3ENP A; 4XAH A; 4WW7 B; 4WWA B; 1ZD0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
