4XEJAL06

Ires bound to bacterial ribosome
Total Genus 18

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
159
structure length
159
Chain Sequence
PKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (16-17)S2 (23-27)TII1 (12-15)TIV1 (20-23)TIV2 (28-31)TIV3 (38-41)TII2 (118-121)TIV4 (77-80)AH2 (138-151)S6 (95-99)TIV5 (79-82)S4 (83-84)TI2 (91-94)TVIII1 (109-112)S9 (134-135)TVIII2 (135-138)TIV8 (155-158)S3 (32-36)S7 (102-106)TI1 (46-49)AH1 (59-77)TIV7 (127-130)Updating...
connected with : NaN
publication title Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2
molecule tags Ribosome
source organism Plautia stali intestine virus
total genus 18
structure length 159
sequence length 159
chains with identical sequence BL06
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AL06 PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.