The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
79
|
sequence length |
250
|
structure length |
250
|
Chain Sequence |
VISQTVRVDIEKLDNLMDLMGELVIARSRILETLKKYNIKELDESLSHLSRITLDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSGRGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Probing the structure and dynamics of Thermotoga maritima histidine kinase CheA to determine domain interactions that regulate autophosphorylation activity
rcsb |
| molecule tags |
Transferase
|
| source organism |
Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
|
| molecule keywords |
Chemotaxis protein CheA
|
| total genus |
79
|
| structure length |
250
|
| sequence length |
250
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.7.13.3: Histidine kinase. |
| pdb deposition date | 2015-01-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02895 | H-kinase_dim | Signal transducing histidine kinase, homodimeric domain |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
