4YK1A

Crystal structure of the bid domain of bep6 from bartonella rochalimae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
MLIPAEQLPPLKEEEVIEKIENDACIQKSLEKIRALSKLIYNNPEILEQDISHINANPKMGRELSERIINSPKSIGRLKGRKIGYIKSQKYKISEQNAKILSNEIFNYADKVSNIRCTIMREHKAKGRRLLQTVKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BID Domain of Type IV Secretion Substrates Forms a Conserved Four-Helix Bundle Topped with a Hook.
pubmed doi rcsb
molecule tags Protein binding
source organism Bartonella rochalimae atcc baa-1498
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
total genus 48
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17841 Bep_C_terminal BID domain of Bartonella effector protein (Bep)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...