4YM7AD

Rna polymerase i structure with an alternative dimer hinge
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
58
Chain Sequence
TATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKETNLSSSISQLKRIQRDFKGLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An alternative RNA polymerase I structure reveals a dimer hinge.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 9
structure length 58
sequence length 89
chains with identical sequence BD, CD, DD, ED, FD
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AD PF08203 RNA_polI_A14 Yeast RNA polymerase I subunit RPA14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...