4YU8A

Crystal structure of neuroblastoma suppressor of tumorigenicity 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
91
structure length
72
Chain Sequence
AWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Neuroblastoma suppressor of tumorigenicity 1
publication title Crystal structure of Neuroblastoma suppressor of tumorigenicity 1
rcsb
source organism Homo sapiens
total genus 8
structure length 72
sequence length 91
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03045 DAN DAN domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...