4ZCEA

Crystal structure of the dust mite allergen der p 23 from dermatophagoides pteronyssinus
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
48
structure length
48
Chain Sequence
TKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Dust mite allergen
publication title Serological, genomic and structural analyses of the major mite allergen Der p 23.
pubmed doi rcsb
source organism Dermatophagoides pteronyssinus
total genus 6
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01607 CBM_14 Chitin binding Peritrophin-A domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...