4ZR7A

The structure of a domain of a functionally unknown protein from bacillus subtilis subsp. subtilis str. 168
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
118
Chain Sequence
EAENDLTQLANKVAVILENHEDQALARSITWELADNLTSIAIIQDEKNHWYSPNLSSITVEQIQHDKDLNKALKDHKKVSKRTGLSDTDTDNERLIVGVPYEKDGKKGMVFLSQSLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a domain of a functionally unknown protein from Bacillus subtilis subsp. subtilis str. 168
rcsb
molecule keywords Sensor histidine kinase ResE
molecule tags Transferase
source organism Bacillus subtilis
total genus 31
structure length 118
sequence length 122
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-05-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...